PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00034.1.g00190.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 264aa    MW: 28565.7 Da    PI: 6.8792
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00034.1.g00190.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.63.6e-30121174155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Zjn_sc00034.1.g00190.1.sm.mk 121 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 174
                                   59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-19118178IPR009057Homeodomain-like
PROSITE profilePS5129410.799118177IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-31118179IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23122174IPR006447Myb domain, plants
PfamPF002494.1E-8124173IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGEEAADDLD LELLGGDDED ERVMEWETGL PGSDELTPLS QPLVPPGLAA AFRIAPEPGR  60
TRLDVHRASA ATVSRLRRAS SSSSESSFPT LAAKADEAAD SSANNKGEAN NNNNSTSTSK  120
RPRLVWTPQL HKRFVDVVAH LGIKNAVPKT IMQLMNVEGL TRENVASHLQ KYRLYVKRMQ  180
GLSNEGPSPS DHIFASTPVP QALVHEVPAP YAGGAAMYHH HQHGPMGVAV GMVPSSYHQQ  240
QNGGYGVSSS SYHHCQQHHH HANK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-19117179163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2065787e-87AB206578.1 Oryza sativa Japonica Group OsPCL1 gene for putative transcription factor, complete cds.
GenBankAK3575057e-87AK357505.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1055A13.
GenBankAP0032777e-87AP003277.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0518C01.
GenBankAP0149577e-87AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126097e-87CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankKC6682607e-87KC668260.1 Hordeum vulgare haplotype 2 LUX (LUX) gene, complete cds.
GenBankKC6682617e-87KC668261.1 Hordeum vulgare haplotype 3 LUX (LUX) gene, complete cds.
GenBankKC6682627e-87KC668262.1 Hordeum vulgare haplotype 4 LUX (LUX) gene, complete cds.
GenBankKC6682637e-87KC668263.1 Hordeum vulgare haplotype 5 LUX (LUX) gene, complete cds.
GenBankKC6682647e-87KC668264.1 Hordeum vulgare haplotype 6 LUX (LUX) gene, complete cds.
GenBankKC6682657e-87KC668265.1 Hordeum vulgare haplotype 7 LUX (LUX) gene, complete cds.
GenBankKC6682667e-87KC668266.1 Hordeum vulgare haplotype 8 LUX (LUX) gene, complete cds.
GenBankKC6682677e-87KC668267.1 Hordeum vulgare haplotype 9 LUX (LUX) gene, complete cds.
GenBankKC6682687e-87KC668268.1 Hordeum vulgare haplotype 10 LUX (LUX) gene, complete cds.
GenBankKC6682697e-87KC668269.1 Hordeum vulgare haplotype 11 LUX (LUX) gene, complete cds.
GenBankKC6682707e-87KC668270.1 Hordeum vulgare haplotype 12 LUX (LUX) gene, complete cds.
GenBankKC6682717e-87KC668271.1 Hordeum vulgare haplotype 13 LUX (LUX) gene, complete cds.
GenBankKC6682727e-87KC668272.1 Hordeum vulgare haplotype 14 LUX (LUX) gene, complete cds.
GenBankKC6682737e-87KC668273.1 Hordeum vulgare haplotype 15 LUX (LUX) gene, complete cds.
GenBankKC6682747e-87KC668274.1 Hordeum vulgare haplotype 16 LUX (LUX) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971425.11e-103PREDICTED: transcription factor PCL1
SwissprotQ94DH37e-93PCL1_ORYSJ; Transcription factor PCL1
TrEMBLK3XL801e-103K3XL80_SETIT; Uncharacterized protein
STRINGSi002653m1e-102(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.31e-48G2-like family protein